Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pbx4 Rabbit Polyclonal Antibody (Biotin)

Pbx4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI429113, AW045266, 2410015M21Rik

UniProt

Q99NE9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDEAQARKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020125

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifi204 (NM_008329) Mouse Tagged Lenti ORF Clone
MR222527L3 10 µg

Ifi204 (NM_008329) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OOCA00464-25T - Human COX8A Primer Pair 2
OOCA00464-25T 25 Tests

OOCA00464-25T - Human COX8A Primer Pair 2

Sign In for Pricing
View Details
SLC26A8 (Testis Anion Transporter 1, Anion Exchange Transporter, Solute Carrier Family 26 Member 8, TAT1, FLJ32714) (MaxLight 650)
138364-ML650 100 µL

SLC26A8 (Testis Anion Transporter 1, Anion Exchange Transporter, Solute Carrier Family 26 Member 8, TAT1, FLJ32714) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Bison bonasus Unknown placental glycoprotein 45J1
MBS1130957-01 0.05 mg (E-Coli)

Recombinant Bison bonasus Unknown placental glycoprotein 45J1

Sign In for Pricing
View Details
Recombinant Bison bonasus Unknown placental glycoprotein 45J1
MBS1130957-02 0.2 mg (E-Coli)

Recombinant Bison bonasus Unknown placental glycoprotein 45J1

Sign In for Pricing
View Details
Recombinant Bison bonasus Unknown placental glycoprotein 45J1
MBS1130957-03 0.5 mg (E-Coli)

Recombinant Bison bonasus Unknown placental glycoprotein 45J1

Sign In for Pricing
View Details