Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jundm2 Rabbit Polyclonal Antibody (HRP)

Jundm2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TI, TIF, Jundm, Jundm2, Jundp2

UniProt

P97875

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Jundm2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf29 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9960R-BF750 100 µL

C19orf29 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
3,3-Dimethyl-1- (1H-pyrazol-1-yl) butan-2-amine hydrochloride
JXB99408-01 100 mg

3,3-Dimethyl-1- (1H-pyrazol-1-yl) butan-2-amine hydrochloride

Sign In for Pricing
View Details
3,3-Dimethyl-1- (1H-pyrazol-1-yl) butan-2-amine hydrochloride
JXB99408-02 1 g

3,3-Dimethyl-1- (1H-pyrazol-1-yl) butan-2-amine hydrochloride

Sign In for Pricing
View Details
Mouse Transthyretin ELISA Kit
MBS722220-01 48 Well

Mouse Transthyretin ELISA Kit

Sign In for Pricing
View Details
Mouse Transthyretin ELISA Kit
MBS722220-02 96 Well

Mouse Transthyretin ELISA Kit

Sign In for Pricing
View Details
Mouse Transthyretin ELISA Kit
MBS722220-03 5x 96 Well

Mouse Transthyretin ELISA Kit

Sign In for Pricing
View Details