Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jundm2 Rabbit Polyclonal Antibody (HRP)

Jundm2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TI, TIF, Jundm, Jundm2, Jundp2

UniProt

P97875

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Jundm2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_112149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (NCAM1/784), 0.2mg/mL
BNUB0784-100 1x 100 µL

CD56 / NCAM (NCAM1/784), 0.2mg/mL

Sign In for Pricing
View Details
Uncoated Human SCG3 (Secretogranin-3) ELISA Kit
E-UNEL-H0403-01 5x 96 Tests

Uncoated Human SCG3 (Secretogranin-3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SCG3 (Secretogranin-3) ELISA Kit
E-UNEL-H0403-02 15x 96 Tests

Uncoated Human SCG3 (Secretogranin-3) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501123 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL
BNC041711-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: 1B3]
AM06519SU-N 100 µL

B7-2 (CD86) Mouse Monoclonal Antibody [Clone ID: 1B3]

Sign In for Pricing
View Details