Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcfap4 Rabbit Polyclonal Antibody (HRP)

Tcfap4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP, AP-4, Tcfa, Tcfap4, bHLHc4, bHLHc41, AI642933, D930048N17Rik

UniProt

Q9JIZ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHGA (Chromogranin A) ELISA Kit
E-EL-H0739-01 24 Tests

Human CHGA (Chromogranin A) ELISA Kit

Sign In for Pricing
View Details
Human CHGA (Chromogranin A) ELISA Kit
E-EL-H0739-02 48 Tests

Human CHGA (Chromogranin A) ELISA Kit

Sign In for Pricing
View Details
Human CHGA (Chromogranin A) ELISA Kit
E-EL-H0739-03 96 Tests

Human CHGA (Chromogranin A) ELISA Kit

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF640R conjugate, 0.1mg/mL
BNC401846-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat α1-AT (Alpha 1-Antitrypsin) ELISA Kit
E-EL-R2420-01 24 Tests

Rat α1-AT (Alpha 1-Antitrypsin) ELISA Kit

Sign In for Pricing
View Details