Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcfap4 Rabbit Polyclonal Antibody (HRP)

Tcfap4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP, AP-4, Tcfa, Tcfap4, bHLHc4, bHLHc41, AI642933, D930048N17Rik

UniProt

Q9JIZ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tcfap4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit
E-MSEL-M0057-01 24 Tests

Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit
E-MSEL-M0057-02 48 Tests

Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit
E-MSEL-M0057-03 96 Tests

Mini Sample Mouse ARG1 (ArginaseI) ELISA Kit

Sign In for Pricing
View Details
Hamartin Rabbit Polyclonal Antibody
HA500199 100 µL

Hamartin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SP1 Recombinant Rabbit Monoclonal Antibody [JF0950]
ET1702-02 100 µL

SP1 Recombinant Rabbit Monoclonal Antibody [JF0950]

Sign In for Pricing
View Details
Endothelial Cells Mouse Monoclonal Antibody [Clone ID: DLP97]
AM26065PU-N 100 µg

Endothelial Cells Mouse Monoclonal Antibody [Clone ID: DLP97]

Sign In for Pricing
View Details