Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes7 Rabbit Polyclonal Antibody (FITC)

Hes7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BHLHb3, bHLHb37

UniProt

Q8BKT2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Hes7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_149030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA7C sgRNA CRISPR Lentivector (Human) (Target 1)
K0805302 1.0 µg DNA

FRA7C sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SUOX Recombinant Antibody, APC-Cy7 Conjugated
bsm-62466R-APC-Cy7 100 µL

SUOX Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
MTERF (MTERF1) (NM_001301134) Human Tagged ORF Clone
RG237852 10 µg

MTERF (MTERF1) (NM_001301134) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe DNA repair helicase rad15 (rad15), partial
MBS1120113 Inquire

Recombinant Schizosaccharomyces pombe DNA repair helicase rad15 (rad15), partial

Sign In for Pricing
View Details
ING3 (NM_019071) Human Tagged Lenti ORF Clone
RC218424L3 10 µg

ING3 (NM_019071) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RGD1305207 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38930126 3x 1.0µg DNA

RGD1305207 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details