Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes7 Rabbit Polyclonal Antibody (FITC)

Hes7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BHLHb3, bHLHb37

UniProt

Q8BKT2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Hes7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_149030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LGMN (Legumain) ELISA Kit
EH1372 96 Tests

Human LGMN (Legumain) ELISA Kit

Sign In for Pricing
View Details
ELISA kit for Human LSP (Liver Specific Lipoprotein)
E-EL-H1548 96 Tests

ELISA kit for Human LSP (Liver Specific Lipoprotein)

Sign In for Pricing
View Details
2410141K09Rik Recombinant Protein (Mouse)
RP111197 100 µg

2410141K09Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Olfr478 siRNA Oligos set (Mouse)
33184174 3x 5 nmol

Olfr478 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
In vivo Grade Recombinant Anti-DNP Ferret IgG1 Isotype Control Antibody
SA158.f1 1 mg

In vivo Grade Recombinant Anti-DNP Ferret IgG1 Isotype Control Antibody

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127707) Human Tagged ORF Clone Lentiviral Particle
RC225664L3V 200 µL

alpha 1 Antitrypsin (SERPINA1) (NM_001127707) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details