Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes7 Rabbit Polyclonal Antibody (Biotin)

Hes7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BHLHb3, bHLHb37

UniProt

Q8BKT2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Hes7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_149030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia fergusonii Multidrug resistance protein MdtL (mdtL), partial
MBS1157033-01 1 mg (E-Coli)

Recombinant Escherichia fergusonii Multidrug resistance protein MdtL (mdtL), partial

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii Multidrug resistance protein MdtL (mdtL), partial
MBS1157033-02 1 mg (Yeast)

Recombinant Escherichia fergusonii Multidrug resistance protein MdtL (mdtL), partial

Sign In for Pricing
View Details
Dipeptidyl-peptidase 5 Mouse mAb for Pear
MBS435367-01 0.1 mL

Dipeptidyl-peptidase 5 Mouse mAb for Pear

Sign In for Pricing
View Details
Dipeptidyl-peptidase 5 Mouse mAb for Pear
MBS435367-02 5x 0.1 mL

Dipeptidyl-peptidase 5 Mouse mAb for Pear

Sign In for Pricing
View Details
Mouse CCL20 (CCL20) ELISA Kit
YP-W22207-01 48 Tests

Mouse CCL20 (CCL20) ELISA Kit

Sign In for Pricing
View Details
Mouse CCL20 (CCL20) ELISA Kit
YP-W22207-02 96 Tests

Mouse CCL20 (CCL20) ELISA Kit

Sign In for Pricing
View Details