Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN2 Rabbit Polyclonal Antibody (FITC)

ACTN2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

1110008F24Rik

UniProt

Q9JI91

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_150371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100505369 3'UTR Luciferase Stable Cell Line
TU112342 1.0 mL

LOC100505369 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Interferon Alpha (IFNa, IFNA1, IFL, IFN, IFN-Alpha, IFNA13, IFN-A, IFNAP22, IFN-Alpha 1b, Interferon Alpha 1b, Interferon, Leukocytic; IFN, Leukocyte)
140889 200 µL

Interferon Alpha (IFNa, IFNA1, IFL, IFN, IFN-Alpha, IFNA13, IFN-A, IFNAP22, IFN-Alpha 1b, Interferon Alpha 1b, Interferon, Leukocytic; IFN, Leukocyte)

Sign In for Pricing
View Details
Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-01 20 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-02 50 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)
HY-P78061-03 100 µg

Angiopoietin-2, Human (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS503717 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details