Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCA1 Rabbit Polyclonal Antibody (FITC)

SMARCA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sn, Snf2l, 5730494M04Rik

UniProt

Q8BS67

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

ChIP, WB

NCBI Accession Number

BAC28931

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL26P33 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV779038 1.0 µg DNA

RPL26P33 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit
MBS8803250-01 48 Well

Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit
MBS8803250-02 96 Well

Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit
MBS8803250-03 5x 96 Well

Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit
MBS8803250-04 10x 96 Well

Human PGAM1 (Phosphoglycerate Mutase 1, Brain) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human UNC93A sgRNA gene knockout kit - Lentiviral human UNC93A sgRNA gene knockout kit (100)
GTR15391498 1 Vial

Lentiviral human UNC93A sgRNA gene knockout kit - Lentiviral human UNC93A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details