Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxp3 Rabbit Polyclonal Antibody (Biotin)

Foxp3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sf, JM2, scu, scurfin

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Foxp3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_473380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IRF6 shRNA (UAS) - Lentiviral human IRF6 shRNA (UAS) plasmid
GTR15078175 1 Vial

Lentiviral human IRF6 shRNA (UAS) - Lentiviral human IRF6 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Boc-Trp(For)-OH
5-06131 25 g

Boc-Trp(For)-OH

Sign In for Pricing
View Details
Inducible Nitric Oxide Synthase, Western Blot Standard (iNOS, iNOS 2, mNOS)
MBS657770-01 0.05 mL

Inducible Nitric Oxide Synthase, Western Blot Standard (iNOS, iNOS 2, mNOS)

Sign In for Pricing
View Details
Inducible Nitric Oxide Synthase, Western Blot Standard (iNOS, iNOS 2, mNOS)
MBS657770-02 5x 0.05 mL

Inducible Nitric Oxide Synthase, Western Blot Standard (iNOS, iNOS 2, mNOS)

Sign In for Pricing
View Details
DGKH (NM_178009) Human Untagged Clone
SC309714 10 µg

DGKH (NM_178009) Human Untagged Clone

Sign In for Pricing
View Details
uL71 (NC_006273) Virus Tagged ORF Clone
VC101250 10 µg

uL71 (NC_006273) Virus Tagged ORF Clone

Sign In for Pricing
View Details