Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vsx1 Rabbit Polyclonal Antibody (FITC)

Vsx1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHX10-li, CHX10-like

UniProt

Q91V10

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vsx1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_473409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herbimycin A, HSP90 inhibitor; Src inhibitor
TBI2567-1MG 1 mg

Herbimycin A, HSP90 inhibitor; Src inhibitor

Sign In for Pricing
View Details
mLST8 Protein Vector (Human) (pPM-C-His)
PV100509 500 ng

mLST8 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)
MBS2135642-01 0.1 mL

HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)
MBS2135642-02 0.2 mL

HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)
MBS2135642-03 0.5 mL

HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)
MBS2135642-04 1 mL

HRP Linked Polyclonal Antibody to Glutathione Peroxidase 3, Plasma (GPX3)

Sign In for Pricing
View Details