Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhb4 Rabbit Polyclonal Antibody (HRP)

Bhlhb4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BETA4, Bhlhb, Beta3b, Bhlhb4, A930001L02Rik

UniProt

Q8BGW3

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bhlhb4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_542372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PALB2 Antibody [DyLight 550]
NB100-60439R 0.1 mL

Rabbit Polyclonal PALB2 Antibody [DyLight 550]

Sign In for Pricing
View Details
Annexin XI CRISPR Activation Plasmid (m2)
sc-419114-ACT-2 20 µg

Annexin XI CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Phospho-IL-1R1 (Tyr496) Rabbit Polyclonal Antibody (PerCP)
orb1609881 100 µL

Phospho-IL-1R1 (Tyr496) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
KLC4 Peptide - N-terminal region
MBS3243473-01 0.1 mg

KLC4 Peptide - N-terminal region

Sign In for Pricing
View Details
KLC4 Peptide - N-terminal region
MBS3243473-02 5x 0.1 mg

KLC4 Peptide - N-terminal region

Sign In for Pricing
View Details
COMP/Cartilage oligomeric matrix protein Recombinant Rabbit Monoclonal Antibody pair (capture)
orb2563298 100 µg

COMP/Cartilage oligomeric matrix protein Recombinant Rabbit Monoclonal Antibody pair (capture)

Sign In for Pricing
View Details