Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhb4 Rabbit Polyclonal Antibody (Biotin)

Bhlhb4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BETA4, Bhlhb, Beta3b, Bhlhb4, A930001L02Rik

UniProt

Q8BGW3

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bhlhb4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_542372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lyme Disease (Borrelia burgdorferi) (Biotin)
L8001-10-Biotin 100 µL

Lyme Disease (Borrelia burgdorferi) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-human glucosidase, beta; acid (includes glucosylceramidase) polyclonal Antibody
MBS712174-01 0.1 mL

Rabbit anti-human glucosidase, beta; acid (includes glucosylceramidase) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human glucosidase, beta; acid (includes glucosylceramidase) polyclonal Antibody
MBS712174-02 5x 0.1 mL

Rabbit anti-human glucosidase, beta; acid (includes glucosylceramidase) polyclonal Antibody

Sign In for Pricing
View Details
LRG1 Antibody
CSB-PA927637 100 µL

LRG1 Antibody

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2), Recombinant, Rat, His-Tag
049629-01 10 µg

Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2), Recombinant, Rat, His-Tag
049629-02 50 µg

Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details