Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sp7 Rabbit Polyclonal Antibody (Biotin)

Sp7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Osx

UniProt

Q6IMK1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Sp7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001032721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK9 (Mitogen-activated Protein Kinase 9, MAP Kinase 9, MAPK 9, JNK-55, Stress-activated Protein Kinase 1a, SAPK1a, Stress-activated Protein Kinase JNK2, c-Jun N-terminal Kinase 2, JNK2, PRKM9, SAPK1A)
129410 100 µg

MAPK9 (Mitogen-activated Protein Kinase 9, MAP Kinase 9, MAPK 9, JNK-55, Stress-activated Protein Kinase 1a, SAPK1a, Stress-activated Protein Kinase JNK2, c-Jun N-terminal Kinase 2, JNK2, PRKM9, SAPK1A)

Sign In for Pricing
View Details
Mouse IgG (H&L) Antibody Alkaline Phosphatase Conjugated
orb347620 1 mg

Mouse IgG (H&L) Antibody Alkaline Phosphatase Conjugated

Sign In for Pricing
View Details
Hsa-miR-182-5p miRNA Agomir
orb1921493-01 5 nmol

Hsa-miR-182-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-182-5p miRNA Agomir
orb1921493-02 10 nmol

Hsa-miR-182-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-182-5p miRNA Agomir
orb1921493-03 20 nmol

Hsa-miR-182-5p miRNA Agomir

Sign In for Pricing
View Details
MYCT1 Protein Vector (Mouse) (pPB-N-His)
PV203363 500 ng

MYCT1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details