Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptges2 Rabbit Polyclonal Antibody (Biotin)

Ptges2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gbf1, Pges2, C79137, Mpges2, 0610038H10Rik

UniProt

Q8BWM0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Ptges2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_598544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID3 Knockout T47D Polyclonal Cells
ARG36798 1 Million

ID3 Knockout T47D Polyclonal Cells

Sign In for Pricing
View Details
MBD3 Knockout AGS Polyclonal Cells
ARG3151 1 Million

MBD3 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit
MBS2500203-01 24 Tests

Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit

Sign In for Pricing
View Details
Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit
MBS2500203-02 48 Tests

Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit

Sign In for Pricing
View Details
Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit
MBS2500203-03 96 Tests

Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit

Sign In for Pricing
View Details
Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit
MBS2500203-04 5x 96 Tests

Porcine COL6alpha3 (Collagen Type VI Alpha 3) ELISA Kit

Sign In for Pricing
View Details