Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES6 Rabbit Polyclonal Antibody (Biotin)

CES6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ces, Ces6, AI266984, 9130231C15Rik

UniProt

Q8QZR3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_598721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytochrome C Oxidase Subunit I ELISA Kit (COX1)
RK01168 96 Tests

Human Cytochrome C Oxidase Subunit I ELISA Kit (COX1)

Sign In for Pricing
View Details
FBXL13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20290061 1.0 µg DNA

FBXL13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RB1CC1 Polyclonal Conjugated Antibody
orb1627856 100 µL

RB1CC1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
DDAH1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61706R-BF555-TR 20 µL

DDAH1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rat Kelch Repeat And BTB Domain Containing Protein 10 (KBTBD10) ELISA Kit
MBS2710007-01 24 Strip Well

Rat Kelch Repeat And BTB Domain Containing Protein 10 (KBTBD10) ELISA Kit

Sign In for Pricing
View Details
Rat Kelch Repeat And BTB Domain Containing Protein 10 (KBTBD10) ELISA Kit
MBS2710007-02 48 Well

Rat Kelch Repeat And BTB Domain Containing Protein 10 (KBTBD10) ELISA Kit

Sign In for Pricing
View Details