Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr5a1 Rabbit Polyclonal Antibody (FITC)

Nr5a1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

UniProt

P33242

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr5a1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_620639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoinositide 3 Kinase, Recombinant, Human, GST-Tag, p110 alpha, p85 alpha (PI3K)
P4073-26C 20 µg

Phosphoinositide 3 Kinase, Recombinant, Human, GST-Tag, p110 alpha, p85 alpha (PI3K)

Sign In for Pricing
View Details
Recombinant Autophagy Related Protein 7 (ATG7)
MBS2123910-01 0.01 mg

Recombinant Autophagy Related Protein 7 (ATG7)

Sign In for Pricing
View Details
Recombinant Autophagy Related Protein 7 (ATG7)
MBS2123910-02 0.05 mg

Recombinant Autophagy Related Protein 7 (ATG7)

Sign In for Pricing
View Details
Recombinant Autophagy Related Protein 7 (ATG7)
MBS2123910-03 0.1 mg

Recombinant Autophagy Related Protein 7 (ATG7)

Sign In for Pricing
View Details
Recombinant Autophagy Related Protein 7 (ATG7)
MBS2123910-04 0.2 mg

Recombinant Autophagy Related Protein 7 (ATG7)

Sign In for Pricing
View Details
Recombinant Autophagy Related Protein 7 (ATG7)
MBS2123910-05 0.5 mg

Recombinant Autophagy Related Protein 7 (ATG7)

Sign In for Pricing
View Details