Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR5A1 Rabbit Polyclonal Antibody (FITC)

NR5A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

UniProt

P33242

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_620639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R13B Protein Vector (Human) (pPM-C-HA)
PV112720 500 ng

PPP1R13B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
C7orf55 (FMC1) (NM_197964) Human Recombinant Protein
TP303326 20 µg

C7orf55 (FMC1) (NM_197964) Human Recombinant Protein

Sign In for Pricing
View Details
RPLP0 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV792693 1.0 µg DNA

RPLP0 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GULO ELISA Kit (Rat) (OKEH08300)
OKEH08300 96 Well

GULO ELISA Kit (Rat) (OKEH08300)

Sign In for Pricing
View Details
TACO1, NT (TACO1, CCDC44, Translational activator of cytochrome c oxidase 1, Coiled-coil domain-containing protein 44, Translational activator of mitochondrially-encoded cytochrome c oxidase I) (MaxLight 550) discontinued
042567-ML550 100 µL

TACO1, NT (TACO1, CCDC44, Translational activator of cytochrome c oxidase 1, Coiled-coil domain-containing protein 44, Translational activator of mitochondrially-encoded cytochrome c oxidase I) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ALS2CL Antibody (Center)
MBS9202119-01 0.08 mL

ALS2CL Antibody (Center)

Sign In for Pricing
View Details