Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR5A1 Rabbit Polyclonal Antibody (FITC)

NR5A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

UniProt

P33242

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_620639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella loihica Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS1005771 Inquire

Recombinant Shewanella loihica Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Mouse Monoclonal CD59 Antibody (BRA-10G) [Alexa Fluor 647]
NBP3-11460AF647 0.1 mL

Mouse Monoclonal CD59 Antibody (BRA-10G) [Alexa Fluor 647]

Sign In for Pricing
View Details
Bovine Retinol binding protein 4, RBP-4 ELISA Kit
MBS1602481-01 48 Well

Bovine Retinol binding protein 4, RBP-4 ELISA Kit

Sign In for Pricing
View Details
Bovine Retinol binding protein 4, RBP-4 ELISA Kit
MBS1602481-02 96 Well

Bovine Retinol binding protein 4, RBP-4 ELISA Kit

Sign In for Pricing
View Details
Bovine Retinol binding protein 4, RBP-4 ELISA Kit
MBS1602481-03 5x 96 Well

Bovine Retinol binding protein 4, RBP-4 ELISA Kit

Sign In for Pricing
View Details
Bovine Retinol binding protein 4, RBP-4 ELISA Kit
MBS1602481-04 10x 96 Well

Bovine Retinol binding protein 4, RBP-4 ELISA Kit

Sign In for Pricing
View Details