Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR5A1 Rabbit Polyclonal Antibody (HRP)

NR5A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

UniProt

P33242

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_620639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLK1 (Phospho Ser764) rabbit pAb
E28PP1569 100 µL

TLK1 (Phospho Ser764) rabbit pAb

Sign In for Pricing
View Details
KCNG3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12175R-BF488 100 µL

KCNG3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, with EPDM ring Cap, Purple, DNase/RNase free - 1000 un. - ABDOS
P10225P 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, with EPDM ring Cap, Purple, DNase/RNase free - 1000 un. - ABDOS

Sign In for Pricing
View Details
FH, NT (FH, Fumarate hydratase, mitochondrial) (MaxLight 405) discontinued
035648-ML405 100 µL

FH, NT (FH, Fumarate hydratase, mitochondrial) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PCNA peptide
orb217722-01 1 mg

PCNA peptide

Sign In for Pricing
View Details
PCNA peptide
orb217722-02 5 mg

PCNA peptide

Sign In for Pricing
View Details