Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc17 Rabbit Polyclonal Antibody (HRP)

Dnajc17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C87112, D9Bwg1371e, 1700025B16Rik

UniProt

Q91WT4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Dnajc17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_631878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)
KTE100594-01 48 Tests

ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)

Sign In for Pricing
View Details
ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)
KTE100594-02 96 Tests

ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)

Sign In for Pricing
View Details
ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)
KTE100594-03 5x 96 Well

ELISA kit for Rat Mannose-6-phosphate isomerase (MPI)

Sign In for Pricing
View Details
Bcl10 (331.3) Alexa Fluor® 488
sc-5273 AF488 200 µg/mL

Bcl10 (331.3) Alexa Fluor® 488

Sign In for Pricing
View Details
Human MBNL1 (NM_021038) AAV Particle
RC208112A1V 250 µL

Human MBNL1 (NM_021038) AAV Particle

Sign In for Pricing
View Details
Anti-Phospho-DARPP32/PPP1R1B (T75) Antibody
P03424-3 100 µL

Anti-Phospho-DARPP32/PPP1R1B (T75) Antibody

Sign In for Pricing
View Details