Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp192 Rabbit Polyclonal Antibody (HRP)

Zfp192 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LD5-, LD5-1, Zfp19, Zfp192, 2510038J07Rik, D430019P06Rik

UniProt

Q8BSL0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_631880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NEURL1B activation kit by CRISPRa
GA110134 1 Kit

Human NEURL1B activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant DPEP1 Monoclonal Antibody
AN301507L-01 50 µL

Recombinant DPEP1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant DPEP1 Monoclonal Antibody
AN301507L-02 100 µL

Recombinant DPEP1 Monoclonal Antibody

Sign In for Pricing
View Details
Nop10 (NM_025403) Mouse Tagged ORF Clone
MG200048 10 µg

Nop10 (NM_025403) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IL5RA (NM_175727) Human Recombinant Protein
TP322553M 100 µg

IL5RA (NM_175727) Human Recombinant Protein

Sign In for Pricing
View Details
RIC3 (C-term) Rabbit Polyclonal Antibody
AP53664PU-N 400 µL

RIC3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details