Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Onecut3 Rabbit Polyclonal Antibody (HRP)

Onecut3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Oc, OC-, Oc3, OC-3

UniProt

Q8K557

Immunogen

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Onecut3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QATISQQLGLELNTVSNFFMNARRRCMNRWAEEPGATPGTGTATATFSKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_631972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Proteasome 20S alpha 3 Antibody [Alexa Fluor 532]
NBP2-97026AF532 0.1 mL

Rabbit Polyclonal Proteasome 20S alpha 3 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
OR8I2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
35676061 1.0 µg DNA

OR8I2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-DAB2IP Antibody Picoband® Fluoro647 Conjugated
A02480-Fluoro647 100 µg/Vial

Anti-DAB2IP Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody
abx301195-01 20 µg

Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody

Sign In for Pricing
View Details
Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody
abx301195-02 50 µg

Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody

Sign In for Pricing
View Details
Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody
abx301195-03 100 µg

Guanine Nucleotide-Binding Protein G (I) /G (S) /G (O) Subunit Gamma-11 (GNG11) Antibody

Sign In for Pricing
View Details