Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2A Rabbit Polyclonal Antibody (FITC)

GATAD2A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C80248, BC031407, 1110066C11Rik

UniProt

Q8CHY6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse GATAD2A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_663571

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata31d1b Mouse Gene Knockout Kit (CRISPR)
KN516555 1 Kit

Spata31d1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SULT2B1 Protein (aa 2-365, His Tag)
PKSH031127 50 µg

Recombinant Human SULT2B1 Protein (aa 2-365, His Tag)

Sign In for Pricing
View Details
3-Bromopicolinic Acid Sodium Salt
TRC-B686600-250MG 250 mg

3-Bromopicolinic Acid Sodium Salt

Sign In for Pricing
View Details
DCTN4 (NM_001135643) Human Over-expression Lysate
LY427644 100 µg

DCTN4 (NM_001135643) Human Over-expression Lysate

Sign In for Pricing
View Details
ASPP1 (PPP1R13B) Human Gene Knockout Kit (CRISPR)
KN421172 1 Kit

ASPP1 (PPP1R13B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Syt2 Mouse Gene Knockout Kit (CRISPR)
KN517085 1 Kit

Syt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details