Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT2 Rabbit Polyclonal Antibody (Biotin)

DMRT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Te, Terra

UniProt

Q8K185

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse DMRT2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAH27669

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Aldo-keto Reductase 1C1/AKR1C1 Antibody (6D10)
NBP1-74042-100ul 100 µL

Mouse Monoclonal Aldo-keto Reductase 1C1/AKR1C1 Antibody (6D10)

Sign In for Pricing
View Details
Slc23a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6173208 1.0 µg DNA

Slc23a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant human ICAM1 Protein, C-His (HEK293)
orb2328564-01 20 µg

Recombinant human ICAM1 Protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human ICAM1 Protein, C-His (HEK293)
orb2328564-02 50 µg

Recombinant human ICAM1 Protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human ICAM1 Protein, C-His (HEK293)
orb2328564-03 100 µg

Recombinant human ICAM1 Protein, C-His (HEK293)

Sign In for Pricing
View Details
Anti-MRE11 Antibody Picoband®, Cy3 Conjugate
A32234-Cy3 100 µg/Vial

Anti-MRE11 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details