Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glis1 Rabbit Polyclonal Antibody (HRP)

Glis1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gli, Gli5, Gli6, GliH1

UniProt

Q8K1M4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_671754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP63 sgRNA CRISPR Lentivector (Human) (Target 2)
K1325303 1.0 µg DNA

MRP63 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal MCM7 Antibody (rMCM7/1468) [DyLight 755]
NBP3-08389IR 100 µL

Mouse Monoclonal MCM7 Antibody (rMCM7/1468) [DyLight 755]

Sign In for Pricing
View Details
Mmu-miR-1931 miRNA Agomir
CMN0612-01 5 nmol

Mmu-miR-1931 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-1931 miRNA Agomir
CMN0612-02 10 nmol

Mmu-miR-1931 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-1931 miRNA Agomir
CMN0612-03 20 nmol

Mmu-miR-1931 miRNA Agomir

Sign In for Pricing
View Details
PRO0618 Human shRNA Plasmid Kit (Locus ID 29052)
TR317128 1 Kit

PRO0618 Human shRNA Plasmid Kit (Locus ID 29052)

Sign In for Pricing
View Details