Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF4 Rabbit Polyclonal Antibody (Biotin)

EBF4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ebf3, O/E-, O/E-4, Olf-1

UniProt

Q8K4J2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EBF4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUSC1 Rabbit Polyclonal Antibody (APC-Cy7)
orb1608573 100 µL

TUSC1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
SFXN3 Polyclonal Antibody
MBS9431549-01 0.05 mL

SFXN3 Polyclonal Antibody

Sign In for Pricing
View Details
SFXN3 Polyclonal Antibody
MBS9431549-02 0.1 mL

SFXN3 Polyclonal Antibody

Sign In for Pricing
View Details
SFXN3 Polyclonal Antibody
MBS9431549-03 5x 0.1 mL

SFXN3 Polyclonal Antibody

Sign In for Pricing
View Details
Cardboard cryobox,100 grid, flip lid, plastic divider,0.5ml
DCH-100ZFG-S-0.5 140pcs/ctn

Cardboard cryobox,100 grid, flip lid, plastic divider,0.5ml

Sign In for Pricing
View Details
NELFE Antibody
DF14763-01 100 µL

NELFE Antibody

Sign In for Pricing
View Details