Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKL1 Rabbit Polyclonal Antibody (HRP)

MKL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

M, Bs, Mal, Mkl, AMKL, Bsac, MRTF, Mkl1, Mrtf-A

UniProt

Q8K4J6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mageb16 Pre-designed siRNA Set B
SI208006B 1 Each

Rat Mageb16 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CXXC4 Rabbit Polyclonal Antibody
JOT-AP08822-01 20 µL

CXXC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXXC4 Rabbit Polyclonal Antibody
JOT-AP08822-02 50 μL

CXXC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXXC4 Rabbit Polyclonal Antibody
JOT-AP08822-03 100 µL

CXXC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Lce1a1 shRNA (UAS) - Lentiviral mouse Lce1a1 shRNA (UAS) plasmid
GTR15166531 1 Vial

Lentiviral mouse Lce1a1 shRNA (UAS) - Lentiviral mouse Lce1a1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
BCR Blocking Peptide
CBP6082-01 1 mg

BCR Blocking Peptide

Sign In for Pricing
View Details