Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Rabbit Polyclonal Antibody (HRP)

Vgll2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik

UniProt

Q8BGW8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANG Antibody
E38PA7264 100 µL

ANG Antibody

Sign In for Pricing
View Details
Rabbi! anti-VPS35 Antibody, Affinity Purified
A304-727A 100 µg

Rabbi! anti-VPS35 Antibody, Affinity Purified

Sign In for Pricing
View Details
Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit
MBS9903513-01 48 Well

Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit
MBS9903513-02 96 Well

Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit
MBS9903513-03 5x 96 Well

Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit

Sign In for Pricing
View Details
Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit
MBS9903513-04 10x 96 Well

Bovine Keratin, Type II Cuticular Hb3 (KRT83) ELISA Kit

Sign In for Pricing
View Details