Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Rabbit Polyclonal Antibody (HRP)

Vgll2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik

UniProt

Q8BGW8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_722481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNKS2 Polyclonal Antibody
E44H10003 100 µL

TNKS2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus NADH-quinone oxidoreductase subunit C/D (nuoC), partial
MBS1008021 Inquire

Recombinant Campylobacter fetus subsp. fetus NADH-quinone oxidoreductase subunit C/D (nuoC), partial

Sign In for Pricing
View Details
NIPA2 CytoSection
TS416472P5 25 Slides

NIPA2 CytoSection

Sign In for Pricing
View Details
RAD26L (ERCC6L2) (NM_020207) Human Over-expression Lysate
LH11090V 100 µg

RAD26L (ERCC6L2) (NM_020207) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Immt Pre-designed siRNA Set A
SI206733A 1 Each

Rat Immt Pre-designed siRNA Set A

Sign In for Pricing
View Details
DPH2 Mouse Monoclonal Antibody [Clone 4E7]
E45M12737V-2 50 µL

DPH2 Mouse Monoclonal Antibody [Clone 4E7]

Sign In for Pricing
View Details