Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem26 Mouse Gene Knockout Kit (CRISPR)
KN517844 1 Kit

Tmem26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF568 conjugate, 0.1mg/mL
BNC681906-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIF22 Rabbit Polyclonal Antibody
TA377801 100 µL

KIF22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF568 conjugate, 0.1mg/mL
BNC683813-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX2 (NM_001098798) Human Over-expression Lysate
LY420335 100 µg

TOX2 (NM_001098798) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP Conjugated GAPDH Recombinant Rabbit Monoclonal Antibody [JF81-04]
ET1702-66 100 µL

HRP Conjugated GAPDH Recombinant Rabbit Monoclonal Antibody [JF81-04]

Sign In for Pricing
View Details