Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL
BNC882877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HRP Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-
H-2001-1 1 mg

HRP Conjugated Ricinus communis Lectin (Castor Bean) -RCA-I-

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody [Clone ID: OTI6C11]
CF807321 100 µg

MALT1 Mouse Monoclonal Antibody [Clone ID: OTI6C11]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS705978 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Zeaxanthin Diacetate
TRC-Z275010-50MG 50 mg

Zeaxanthin Diacetate

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) S protein RBD (R408I), His Tag
SPD-S52H8-1mg 1 mg

SARS-CoV-2 (COVID-19) S protein RBD (R408I), His Tag

Sign In for Pricing
View Details