Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

A830039H10RIK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC12B activation kit by CRISPRa
GA117914 1 Kit

Human CLEC12B activation kit by CRISPRa

Sign In for Pricing
View Details
Ttr (NM_013697) Mouse Tagged ORF Clone
MG200992 10 µg

Ttr (NM_013697) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LDB2 (NM_001290) Human Over-expression Lysate
LC400529 20 µg

LDB2 (NM_001290) Human Over-expression Lysate

Sign In for Pricing
View Details
XPA (NM_000380) Human Recombinant Protein
TP304872M 100 µg

XPA (NM_000380) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627553 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PTP epsilon (PTPRE) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]
TA501025AM 100 µL

PTP epsilon (PTPRE) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details