Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (HRP)

A830039H10RIK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD14 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-19469R-BF680 100 µL

PSMD14 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal KRTHA2 Antibody
H00003882-D01P 0.1 mg

Rabbit Polyclonal KRTHA2 Antibody

Sign In for Pricing
View Details
NPAS4 Rabbit Polyclonal Antibody (PE)
orb489494 100 µL

NPAS4 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Bcl-2 Mouse mAb, BF350 conjugated
orb2370693 100 µL

Bcl-2 Mouse mAb, BF350 conjugated

Sign In for Pricing
View Details
PDGFRα Mouse Monoclonal Antibody (7A3)
ABM40334-01 30 µL

PDGFRα Mouse Monoclonal Antibody (7A3)

Sign In for Pricing
View Details
PDGFRα Mouse Monoclonal Antibody (7A3)
ABM40334-02 100 µL

PDGFRα Mouse Monoclonal Antibody (7A3)

Sign In for Pricing
View Details