Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (HRP)

A830039H10RIK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody [Clone ID: OTI6A7]
TA502974 100 µL

LIM Kinase 1 (LIMK1) Mouse Monoclonal Antibody [Clone ID: OTI6A7]

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)
TRV-0059781-01 20 µL

Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)
TRV-0059781-02 100 µL

Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)
TRV-0059781-03 200 µL

Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)
TRV-0059781-04 1 mL

Monoclonal Antibody to Glutamate Receptor, Metabotropic 1 (GRM1)

Sign In for Pricing
View Details
METTL1, ID (METTL1, C12orf1, tRNA (guanine-N (7) -) -methyltransferase, Methyltransferase-like protein 1, tRNA (guanine (46) -N (7) ) -methyltransferase, tRNA (m7G46) -methyltransferase) (MaxLight 650) discontinued
038383-ML650 100 µL

METTL1, ID (METTL1, C12orf1, tRNA (guanine-N (7) -) -methyltransferase, Methyltransferase-like protein 1, tRNA (guanine (46) -N (7) ) -methyltransferase, tRNA (m7G46) -methyltransferase) (MaxLight 650) discontinued

Sign In for Pricing
View Details