Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830039H10RIK Rabbit Polyclonal Antibody (Biotin)

A830039H10RIK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ml, Mlr1

UniProt

Q8CJG4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-6412 miRNA Mimic
CMM1230-01 5 nmol

Mmu-miR-6412 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6412 miRNA Mimic
CMM1230-02 10 nmol

Mmu-miR-6412 miRNA Mimic

Sign In for Pricing
View Details
Porcine platelet-associated Complement 3 (PAC3) ELISA Kit
MBS263054-01 48 Well

Porcine platelet-associated Complement 3 (PAC3) ELISA Kit

Sign In for Pricing
View Details
Porcine platelet-associated Complement 3 (PAC3) ELISA Kit
MBS263054-02 96 Well

Porcine platelet-associated Complement 3 (PAC3) ELISA Kit

Sign In for Pricing
View Details
Porcine platelet-associated Complement 3 (PAC3) ELISA Kit
MBS263054-03 5x 96 Well

Porcine platelet-associated Complement 3 (PAC3) ELISA Kit

Sign In for Pricing
View Details
Porcine platelet-associated Complement 3 (PAC3) ELISA Kit
MBS263054-04 10x 96 Well

Porcine platelet-associated Complement 3 (PAC3) ELISA Kit

Sign In for Pricing
View Details