Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A630025C20RIK Rabbit Polyclonal Antibody (HRP)

A630025C20RIK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ml, Mlr2, Gm340, mKIAA1795, 3110023F06Rik, A630025C20Rik

UniProt

Q6ZPI3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Porcine IL-10 (Interleukin 10) ELISA Kit
E-UNEL-P0004-01 5x 96 Tests

Uncoated Porcine IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-10 (Interleukin 10) ELISA Kit
E-UNEL-P0004-02 15x 96 Tests

Uncoated Porcine IL-10 (Interleukin 10) ELISA Kit

Sign In for Pricing
View Details
PhosphoWorks™ Luminometric ATP Assay Kit *Maximized Luminescence*
21610-AAT 1 Plate

PhosphoWorks™ Luminometric ATP Assay Kit *Maximized Luminescence*

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22798-01 50 μL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22798-02 100 µL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22798-03 1 mL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details