Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbfa2t2 Rabbit Polyclonal Antibody (HRP)

Cbfa2t2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MTGR, MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik

UniProt

O70374

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-[ (3,4-Dimethoxythiophen-2-yl) methylidene]hydroxylamine
FPD81682-01 50 mg

N-[ (3,4-Dimethoxythiophen-2-yl) methylidene]hydroxylamine

Sign In for Pricing
View Details
N-[ (3,4-Dimethoxythiophen-2-yl) methylidene]hydroxylamine
FPD81682-02 0.5 g

N-[ (3,4-Dimethoxythiophen-2-yl) methylidene]hydroxylamine

Sign In for Pricing
View Details
PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (Biotin)
250486-Biotin 100 µL

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota) (Biotin)

Sign In for Pricing
View Details
Casein Kinase II beta (phospho Ser209) Polyclonal Antibody
MBS8520506-01 0.1 mg

Casein Kinase II beta (phospho Ser209) Polyclonal Antibody

Sign In for Pricing
View Details
Casein Kinase II beta (phospho Ser209) Polyclonal Antibody
MBS8520506-02 0.1 mL (AF635)

Casein Kinase II beta (phospho Ser209) Polyclonal Antibody

Sign In for Pricing
View Details
Casein Kinase II beta (phospho Ser209) Polyclonal Antibody
MBS8520506-03 0.1 mL (AF610)

Casein Kinase II beta (phospho Ser209) Polyclonal Antibody

Sign In for Pricing
View Details