Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp445 Rabbit Polyclonal Antibody (Biotin)

Zfp445 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF16, ZNF168, Znf445, mszf29, mszf50, AW610627

UniProt

Q8R2V3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Zfp445

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NFRKSSHHYNNKYGEGLRGTGEGFGVYQNTGLKENGKDRYGETSRKSWHA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_775540

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL13 receptor alpha 1 (IL13RA1) Human qPCR Template Standard (NM_001560)
HK203967 1 Kit

IL13 receptor alpha 1 (IL13RA1) Human qPCR Template Standard (NM_001560)

Sign In for Pricing
View Details
PTPN6 ELISA Kit (Human) (OKAN04845)
OKAN04845 96 Well

PTPN6 ELISA Kit (Human) (OKAN04845)

Sign In for Pricing
View Details
Recombinant Ranunculus macranthus Photosystem II reaction center protein I (psbI), partial
MBS1048963-01 1 mg (E-Coli)

Recombinant Ranunculus macranthus Photosystem II reaction center protein I (psbI), partial

Sign In for Pricing
View Details
Recombinant Ranunculus macranthus Photosystem II reaction center protein I (psbI), partial
MBS1048963-02 1 mg (Yeast)

Recombinant Ranunculus macranthus Photosystem II reaction center protein I (psbI), partial

Sign In for Pricing
View Details
Goat Theileriidae antibody (Theileriidae-Ab) ELISA Kit
YP-W75179-01 48 Tests

Goat Theileriidae antibody (Theileriidae-Ab) ELISA Kit

Sign In for Pricing
View Details
Goat Theileriidae antibody (Theileriidae-Ab) ELISA Kit
YP-W75179-02 96 Tests

Goat Theileriidae antibody (Theileriidae-Ab) ELISA Kit

Sign In for Pricing
View Details