Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helt Rabbit Polyclonal Antibody (HRP)

Helt Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mgn, Hesl, mega, megane, Heslike, A830086M02

UniProt

Q7TS99

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Helt

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_776150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOV10L1 ORF Vector (Human) (pORF)
ORF025184 1.0 µg DNA

MOV10L1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
LPAL2 Antibody (FITC)
orb44955-01 50 µg

LPAL2 Antibody (FITC)

Sign In for Pricing
View Details
LPAL2 Antibody (FITC)
orb44955-02 100 µg

LPAL2 Antibody (FITC)

Sign In for Pricing
View Details
PHLDA2 (IPL, BRW1C, BWR1C, HLDA2, TSSC3, Pleckstrin Homology Like Domain Family A, Member 2) (MaxLight 650)
MBS6448381-01 0.1 mL

PHLDA2 (IPL, BRW1C, BWR1C, HLDA2, TSSC3, Pleckstrin Homology Like Domain Family A, Member 2) (MaxLight 650)

Sign In for Pricing
View Details
PHLDA2 (IPL, BRW1C, BWR1C, HLDA2, TSSC3, Pleckstrin Homology Like Domain Family A, Member 2) (MaxLight 650)
MBS6448381-02 5x 0.1 mL

PHLDA2 (IPL, BRW1C, BWR1C, HLDA2, TSSC3, Pleckstrin Homology Like Domain Family A, Member 2) (MaxLight 650)

Sign In for Pricing
View Details
Rat Hars2 Pre-designed siRNA Set A
SI206108A 1 Each

Rat Hars2 Pre-designed siRNA Set A

Sign In for Pricing
View Details