Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bola2 Rabbit Polyclonal Antibody (HRP)

Bola2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BolA-2, 1110025L05Rik

UniProt

Q8BGS2

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRM2 Rabbit Polyclonal Antibody
TA361344 100 µL

CHRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dlk1 Rat Monoclonal Antibody [Clone ID: 24-11]
AM26511RP-N 50 Tests

Dlk1 Rat Monoclonal Antibody [Clone ID: 24-11]

Sign In for Pricing
View Details
ADH4 Recombinant Rabbit Monoclonal Antibody [JE62-24]
HA722570 100 µL

ADH4 Recombinant Rabbit Monoclonal Antibody [JE62-24]

Sign In for Pricing
View Details
Histone H4 Recombinant Rabbit monoclonal Antibody
HA750294 100 µL

Histone H4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
OR5K3 Human Gene Knockout Kit (CRISPR)
KN422486 1 Kit

OR5K3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SMC4 Antibody
RC-16042-01 50 μL

Recombinant SMC4 Antibody

Sign In for Pricing
View Details