Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bola2 Rabbit Polyclonal Antibody (Biotin)

Bola2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BolA-2, 1110025L05Rik

UniProt

Q8BGS2

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat cytochrome P4502E1 ELISA Kit
SL1007Ra-01 48 Tests

Rat cytochrome P4502E1 ELISA Kit

Sign In for Pricing
View Details
Rat cytochrome P4502E1 ELISA Kit
SL1007Ra-02 96 Tests

Rat cytochrome P4502E1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal DUSP26 Antibody
NBP2-84834-0.1mL 0.1 mL

Rabbit Polyclonal DUSP26 Antibody

Sign In for Pricing
View Details
Recombinant Anti-APG5L/ATG5 antibody (Rabbit mAb)
GB15401-50 50 μL

Recombinant Anti-APG5L/ATG5 antibody (Rabbit mAb)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human OR2AJ1 (Olfactory receptor family 2 subfamily AJ member 1) Expressed in vitro E.coli expression system, Full Length
MPX3332K Each

Magic™ Membrane Protein Human OR2AJ1 (Olfactory receptor family 2 subfamily AJ member 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Rat Yod1 Pre-designed siRNA Set B
SI216113B 1 Each

Rat Yod1 Pre-designed siRNA Set B

Sign In for Pricing
View Details