Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C330003B14RIK Rabbit Polyclonal Antibody (FITC)

C330003B14RIK Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cph, Eso, Cphx, Cphx2, Cphx3, Eso-1, C80129, Gm2104, Gm2135, AU019881, AU023336, 100039213, 100039280, C330003B14Rik

UniProt

Q8BX39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse C330003B14RIK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_780551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF250 activation kit by CRISPRa
GA111783 1 Kit

Human ZNF250 activation kit by CRISPRa

Sign In for Pricing
View Details
Hexafluoroacetone Trihydrate
TRC-H294913-250MG 250 mg

Hexafluoroacetone Trihydrate

Sign In for Pricing
View Details
Human Resistin Recombinant Rabbit monoclonal Antibody
HA723659 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Gastrin Releasing Peptide (GRP) activation kit by CRISPRa
GA101977 1 Kit

Human Gastrin Releasing Peptide (GRP) activation kit by CRISPRa

Sign In for Pricing
View Details
JUN Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*
67018-AAT 1 Plate

JUN Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*

Sign In for Pricing
View Details
Recombinant Human FCER2 Protein (His Tag)
PDMH100246-01 20 µg

Recombinant Human FCER2 Protein (His Tag)

Sign In for Pricing
View Details