Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C330003B14RIK Rabbit Polyclonal Antibody (HRP)

C330003B14RIK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cph, Eso, Cphx, Cphx2, Cphx3, Eso-1, C80129, Gm2104, Gm2135, AU019881, AU023336, 100039213, 100039280, C330003B14Rik

UniProt

Q8BX39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse C330003B14RIK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_780551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-,  5nm
GP-3801-5 1 mL

Colloidal Gold Conjugated Helix aspersa Lectin (Garden Snail) -HAA-, 5nm

Sign In for Pricing
View Details
TNFRSF14 Recombinant Rabbit monoclonal Antibody
HA751042 100 µL

TNFRSF14 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human RBM17 activation kit by CRISPRa
GA113820 1 Kit

Human RBM17 activation kit by CRISPRa

Sign In for Pricing
View Details
Galanthus nivalis Gel -GNA- Immobilized Lectin
A-7401-2 2 mL

Galanthus nivalis Gel -GNA- Immobilized Lectin

Sign In for Pricing
View Details
(S)-1-(2-Chloro-acetyl)-pyrrolidine-2-carboxylic Acid
TRC-S048790-500MG 500 mg

(S)-1-(2-Chloro-acetyl)-pyrrolidine-2-carboxylic Acid

Sign In for Pricing
View Details
CLN6 Human Gene Knockout Kit (CRISPR)
KN401904 1 Kit

CLN6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details