Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbfox2 Rabbit Polyclonal Antibody (FITC)

Rbfox2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fxh, Rbm, Fbm2, Rbm9, Hrnbp2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001104297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetrandrine (Fanchinine)
MBS8506434-01 100 mg

Tetrandrine (Fanchinine)

Sign In for Pricing
View Details
Tetrandrine (Fanchinine)
MBS8506434-02 5x 100 mg

Tetrandrine (Fanchinine)

Sign In for Pricing
View Details
Benzyl (4-methoxybutyl) amine
PUA42861-01 250 mg

Benzyl (4-methoxybutyl) amine

Sign In for Pricing
View Details
Benzyl (4-methoxybutyl) amine
PUA42861-02 2.5 g

Benzyl (4-methoxybutyl) amine

Sign In for Pricing
View Details
ATM Rabbit Polyclonal Antibody (Cy7)
orb1052801 100 µL

ATM Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
SGK269, NT (PEAK1, KIAA2002, Pseudopodium-enriched atypical kinase 1, Sugen kinase 269, Tyrosine-protein kinase SgK269) (AP) discontinued
041662-AP 200 µL

SGK269, NT (PEAK1, KIAA2002, Pseudopodium-enriched atypical kinase 1, Sugen kinase 269, Tyrosine-protein kinase SgK269) (AP) discontinued

Sign In for Pricing
View Details