Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbfox2 Rabbit Polyclonal Antibody (HRP)

Rbfox2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fxh, Rbm, Fbm2, Rbm9, Hrnbp2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001104297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMD4 ORF Vector (Human) (pORF)
ORF010521 1.0 µg DNA

TIMD4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human TXNDC12 shRNA (UAS) - Lentiviral human TXNDC12 shRNA (UAS, RFP) (25)
GTR15078335 1 Vial

Lentiviral human TXNDC12 shRNA (UAS) - Lentiviral human TXNDC12 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Norrin, NDP ELISA Kit
MBS901439-01 24 Well (LIMIT 1)

Human Norrin, NDP ELISA Kit

Sign In for Pricing
View Details
Human Norrin, NDP ELISA Kit
MBS901439-02 48 Well

Human Norrin, NDP ELISA Kit

Sign In for Pricing
View Details
Human Norrin, NDP ELISA Kit
MBS901439-03 96 Well

Human Norrin, NDP ELISA Kit

Sign In for Pricing
View Details
Human Norrin, NDP ELISA Kit
MBS901439-04 5x 96 Well

Human Norrin, NDP ELISA Kit

Sign In for Pricing
View Details