Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbfox2 Rabbit Polyclonal Antibody (Biotin)

Rbfox2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fxh, Rbm, Fbm2, Rbm9, Hrnbp2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001104297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EF-hand calcium-binding domain-containing protein 6 (EFCAB6) Elisa Kit
EK712154 96 Well

Human EF-hand calcium-binding domain-containing protein 6 (EFCAB6) Elisa Kit

Sign In for Pricing
View Details
(αR) -2,3-Dichloro-6-fluoro-α- (trifluoromethyl) benzenemethanamine
PC1008478-01 100 mg

(αR) -2,3-Dichloro-6-fluoro-α- (trifluoromethyl) benzenemethanamine

Sign In for Pricing
View Details
(αR) -2,3-Dichloro-6-fluoro-α- (trifluoromethyl) benzenemethanamine
PC1008478-02 250 mg

(αR) -2,3-Dichloro-6-fluoro-α- (trifluoromethyl) benzenemethanamine

Sign In for Pricing
View Details
CROCCL1 Protein Vector (Human) (pPM-C-HA)
16853021 500 ng

CROCCL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human COX15, Cytochrome C Oxidase Assembly Homolog (COX15) ELISA Kit
abx386646 96 Tests

Human COX15, Cytochrome C Oxidase Assembly Homolog (COX15) ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Spike S1 Rabbit pAb
E920136 100 µL

SARS-CoV-2 Spike S1 Rabbit pAb

Sign In for Pricing
View Details