Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM35B Rabbit Polyclonal Antibody (FITC)

RBM35B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rbm35, Rbm35b, 9530027K23Rik

UniProt

Q8K0G8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ' target='_blank'>EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_789808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAK3 (NAA30) (NM_001011713) Human Over-expression Lysate
LY423299 100 µg

MAK3 (NAA30) (NM_001011713) Human Over-expression Lysate

Sign In for Pricing
View Details
STIR ELEMENT, BARBELL, AlNiCo Magnet, 5.5MGO, Encapsulated with Isostatically Molded, FDA Approved, Pure PTFE, 8.0mm Diameter, 55.0mm Length, 260°C Max Operating Temp for Coating
VP 776-8-55BB 1 EACH

STIR ELEMENT, BARBELL, AlNiCo Magnet, 5.5MGO, Encapsulated with Isostatically Molded, FDA Approved, Pure PTFE, 8.0mm Diameter, 55.0mm Length, 260°C Max Operating Temp for Coating

Sign In for Pricing
View Details
Mmu-miR-3964 antagomir
HY-RI03128A-01 5 nmol

Mmu-miR-3964 antagomir

Sign In for Pricing
View Details
Mmu-miR-3964 antagomir
HY-RI03128A-02 20 nmol

Mmu-miR-3964 antagomir

Sign In for Pricing
View Details
PSENEN (Presenilin Enhancer Protein 2, PEN2, Gamma-secretase Subunit PEN-2, MDS033, MSTP064) APC
MBS6138481-01 0.1 mL

PSENEN (Presenilin Enhancer Protein 2, PEN2, Gamma-secretase Subunit PEN-2, MDS033, MSTP064) APC

Sign In for Pricing
View Details
PSENEN (Presenilin Enhancer Protein 2, PEN2, Gamma-secretase Subunit PEN-2, MDS033, MSTP064) APC
MBS6138481-02 5x 0.1 mL

PSENEN (Presenilin Enhancer Protein 2, PEN2, Gamma-secretase Subunit PEN-2, MDS033, MSTP064) APC

Sign In for Pricing
View Details