Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM35B Rabbit Polyclonal Antibody (FITC)

RBM35B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rbm35, Rbm35b, 9530027K23Rik

UniProt

Q8K0G8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ' target='_blank'>EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_789808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bbs2 (NM_053618) Rat Tagged ORF Clone Lentiviral Particle
RR205555L4V 200 µL

Bbs2 (NM_053618) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human CTSL Recombinant Protein
PPT-12119 100 µg

Human CTSL Recombinant Protein

Sign In for Pricing
View Details
Tmprss2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3945807 1.0 µg DNA

Tmprss2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse 1600014C10Rik shRNA (UAS) - Lentiviral mouse 1600014C10Rik shRNA (UAS, GFP) plasmid
GTR15269362 1 Vial

Lentiviral mouse 1600014C10Rik shRNA (UAS) - Lentiviral mouse 1600014C10Rik shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RPS6KA6 Polyclonal Antibody
MBS9134868-01 0.02 mL

RPS6KA6 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KA6 Polyclonal Antibody
MBS9134868-02 0.1 mL

RPS6KA6 Polyclonal Antibody

Sign In for Pricing
View Details