Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A830053O21Rik Rabbit Polyclonal Antibody (HRP)

A830053O21Rik Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fin, Fingerin, A830053O21Rik

UniProt

Q5RJB0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse A830053O21Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_796156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Soluble Glucoprotein 130 ELISA Kit
MBS746144-01 48 Well

Guinea pig Soluble Glucoprotein 130 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Soluble Glucoprotein 130 ELISA Kit
MBS746144-02 96 Well

Guinea pig Soluble Glucoprotein 130 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Soluble Glucoprotein 130 ELISA Kit
MBS746144-03 5x 96 Well

Guinea pig Soluble Glucoprotein 130 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Soluble Glucoprotein 130 ELISA Kit
MBS746144-04 10x 96 Well

Guinea pig Soluble Glucoprotein 130 ELISA Kit

Sign In for Pricing
View Details
TCRP1 Rabbit pAb, AE conjugated
orb2874018 100 µL

TCRP1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
CYP2A13 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-14148R-BF488 100 µL

CYP2A13 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details